Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Protein Phosphorylation Ser / Thr Kinases Other Kinases

Recombinant Human TGF beta Receptor II protein (Fc Chimera) (ab83578)

Recombinant Human TGF beta Receptor II protein (Fc Chimera) (ab83578)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
Anti-PKN antibody [EPR3237] (ab108976)
Product image
Human WNK2 knockout HEK-293T cell lysate (ab258286)
Product image
Human STK38L (Ndr2) knockout HeLa cell lysate (ab259162)
Product image
Anti-ANKK1 antibody (ab64812)

Description

  • Product name

    Recombinant Human TGF beta Receptor II protein (Fc Chimera)
    See all TGF beta Receptor II proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    P37173
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQL CKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETV CHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFS EEYNTSNPDLLLVIFQ
    • Amino acids

      1 to 166
    • Additional sequence information

      Fusion of aa 1-166 of human TGF beta receptor type II and aa 93-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.

Preparation and Storage

  • Alternative names

    • AAT3
    • FAA3
    • LDS1B
    • LDS2
    • LDS2B
    • MFS2
    • RIIC
    • TAAD2
    • TbetaR II
    • TbetaR-II
    • TGF beta receptor type 2
    • TGF beta receptor type II
    • TGF beta receptor type IIB
    • TGF beta type II receptor
    • TGF-beta receptor type II
    • TGF-beta receptor type-2
    • TGF-beta type II receptor
    • TGF-beta-R2
    • TGFB R2
    • TGFbeta - RII
    • TGFbeta RII
    • Tgfbr2
    • TGFR-2
    • TGFR2_HUMAN
    • Transforming growth factor beta receptor II
    • Transforming growth factor beta receptor type II
    • Transforming growth factor beta receptor type IIC
    • Transforming growth factor, beta receptor II (70/80kDa)
    • transforming growth factor, beta receptor II alpha
    • transforming growth factor, beta receptor II beta
    • transforming growth factor, beta receptor II delta
    • transforming growth factor, beta receptor II epsilon
    • transforming growth factor, beta receptor II gamma
    • Transforming growth factor-beta receptor type II
    see all
  • Function

    Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
  • Involvement in disease

    Defects in TGFBR2 are the cause of hereditary non-polyposis colorectal cancer type 6 (HNPCC6) [MIM:614331]. Mutations in more than one gene locus can be involved alone or in combination in the production of the HNPCC phenotype (also called Lynch syndrome). Most families with clinically recognized HNPCC have mutations in either MLH1 or MSH2 genes. HNPCC is an autosomal, dominantly inherited disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early onset colorectal carcinoma (CRC) and extra-colonic cancers of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world, and accounts for 15% of all colon cancers. Cancers in HNPCC originate within benign neoplastic polyps termed adenomas. Clinically, HNPCC is often divided into two subgroups. Type I: hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II: patients have an increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term "suspected HNPCC" or "incomplete HNPCC" can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. HNPCC6 is a type of colorectal cancer complying with the clinical criteria of HNPCC, except that the onset of cancer was beyond 50 years of age in all cases.
    Defects in TGFBR2 are a cause of esophageal cancer (ESCR) [MIM:133239].
    Defects in TGFBR2 are the cause of Loeys-Dietz syndrome type 1B (LDS1B) [MIM:610168]. LDS1 is an aortic aneurysm syndrome with widespread systemic involvement. The disorder is characterized by arterial tortuosity and aneurysms, craniosynostosis, hypertelorism, and bifid uvula or cleft palate. Other findings include exotropy, micrognathia and retrognathia, structural brain abnormalities, intellectual deficit, congenital heart disease, translucent skin, joint hyperlaxity and aneurysm with dissection throughout the arterial tree.
    Defects in TGFBR2 are the cause of Loeys-Dietz syndrome type 2B (LDS2B) [MIM:610380]. An aortic aneurysm syndrome with widespread systemic involvement. Physical findings include prominent joint laxity, easy bruising, wide and atrophic scars, velvety and translucent skin with easily visible veins, spontaneous rupture of the spleen or bowel, diffuse arterial aneurysms and dissections, and catastrophic complications of pregnancy, including rupture of the gravid uterus and the arteries, either during pregnancy or in the immediate postpartum period. LDS2 is characterized by the absence of craniofacial abnormalities with the exception of bifid uvula that can be present in some patients. Note=TGFBR2 mutations Cys-460 and His-460 have been reported to be associated with thoracic aortic aneurysms and dissection (TAAD). This phenotype, also known as thoracic aortic aneurysms type 3 (AAT3), is distinguised from LDS2B by having aneurysms restricted to thoracic aorta. As individuals carrying these mutations also exhibit descending aortic disease and aneurysms of other arteries (PubMed:16027248), they have been considered as LDS2B by the OMIM resource.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on a Ser/Thr residue in the cytoplasmic domain.
  • Cellular localization

    Cell membrane.
  • Target information above from: UniProt accession P37173 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant Human TGF beta Receptor II protein (Fc Chimera) (ab83578)
    Functional Studies - Recombinant Human TGF beta Receptor II protein (Fc Chimera) (ab83578)
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification. The triangle indicates theoretical pI and MW of the protein.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human TGF beta Receptor II protein (Fc Chimera) (ab83578)

  •  
  • Product image

    Recombinant Human TGF beta Receptor II protein (Fc Chimera) (ab223104)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant human TGF beta Receptor II protein (ab63173)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant Human TGF beta Receptor II protein (ab191920)

    Applications: HPLC, SDS-PAGE

  •  
  • Product image

    Recombinant mouse TGF beta Receptor II protein (ab204100)

    Applications: FuncS, SDS-PAGE, WB

  •  
  • Product image

    Recombinant Human TGF beta Receptor II protein (ab222436)

    Applications: SDS-PAGE

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.