Recombinant Human SPINK1/P12 protein (ab152041)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human SPINK1/P12 protein
See all SPINK1/P12 proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab152041 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILI QKSGPCVDHH HHHH -
Predicted molecular weight
7 kDa including tags -
Amino acids
24 to 79 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab152041 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Additional notes
This product was previously labelled as SPINK1
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 6.00
Constituents: 0.392% MES, 0.05% Brij, 0.02% Calcium chloride, 0.02% DTT, 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride
General Info
-
Alternative names
- ISK1_HUMAN
- Pancreatic secretory trypsin inhibitor
- Pancreatic serine protease inhibitor Kazal
see all -
Function
Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.
In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. -
Involvement in disease
Pancreatitis, hereditary
Tropical calcific pancreatitis -
Sequence similarities
Contains 1 Kazal-like domain. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab152041 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 6.00
Constituents: 0.392% MES, 0.05% Brij, 0.02% Calcium chloride, 0.02% DTT, 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride