Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Chemokines Alpha Chemokines (CXC)

Recombinant human SDF1 beta protein (Animal Free) (ab217454)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 98% SDS-PAGE
  • Active: Yes
  • Suitable for: HPLC, SDS-PAGE, Functional Studies

You may also be interested in

Synthetic Human IP10 protein (Animal Free) (ab175163)
Recombinant mouse CXCL1/GRO alpha protein (ab202817)
Product image
Recombinant human CXCL2 protein (Active) (ab256023)
Product image
Recombinant Human IP10 protein (ab269210)

Description

  • Product name

    Recombinant human SDF1 beta protein (Animal Free)
    See all SDF1 beta proteins and peptides
  • Biological activity

    Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 20.0-80.0 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    assessed also by HPLC
  • Expression system

    Escherichia coli
  • Accession

    P48061
  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVC IDPKLKWIQEYLEKALNKRFKM
    • Predicted molecular weight

      9 kDa
    • Amino acids

      22 to 93
    • Additional sequence information

      Mature protein without signal peptide.

Preparation and Storage

  • Alternative names

    • C-X-C motif chemokine 12
    • cxcl12
    • hIRH
    • hSDF-1
    • Intercrine reduced in hepatomas
    • IRH
    • PBSF
    • Pre-B cell growth-stimulating factor
    • SCYB12
    • SDF 1 beta
    • SDF-1
    • SDF-1-alpha(3-67)
    • SDF1
    • SDF1_HUMAN
    • SDF1b
    • Stromal cell derived factor 1
    • TLSF
    • TPAR1
    see all
  • Function

    Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to another C-X-C chemokine receptor CXCR7, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and CXCR7, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of CXCR7 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.
  • Tissue specificity

    Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Developmental stage

    Isoform Alpha is ubiquitously expressed in fetal tissues. Isoform Beta and isoform Delta have more limited expression patterns, with highest levels detected in fetal spleen and fetal liver, respectively. Isoform Gamma and isoform Theta are weakly detected in fetal kidney.
  • Post-translational
    modifications

    Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P48061 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human SDF1 beta protein (Animal Free) (ab217454)

  •  
  • Recombinant mouse SDF1 beta protein (ab51940)

    Applications: FuncS, SDS-PAGE

  •  
  • Synthetic Human SDF1 beta protein (Animal Free) (ab175159)

    Applications: HPLC

  •  
  • Recombinant human SDF1 beta protein (ab9800)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human SDF1 beta protein (ab78611)

    Applications: SDS-PAGE

  •  
  • Recombinant rat SDF1 beta protein (ab201384)

    Applications: FuncS, HPLC, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PYK2 (phospho Y402) antibody (ab131543)

  •  
  • Anti-CLEC9A antibody [7H11] (ab104909)

  •  
  • Anti-KLRG1 antibody [2F1] (ab25054)

  •  
  • Product image

    Membrane Fraction WB Cocktail (ab140365)

  •  
  • Product image

    Anti-CD168 antibody - N-terminal (ab185728)

  •  
  • Product image

    Anti-Vimentin antibody - C-terminal (ab229622)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.