Recombinant human PPIL1 protein (ab79247)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: WB, Functional Studies, SDS-PAGE
-
Product name
Recombinant human PPIL1 protein -
Biological activity
Specific activity is > 300 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.Activity Assay
- Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
- Add 10 µl of recombinant PPIL1 protein with 1 µg in assay buffer.
- Mix by inversion and equilibrate to 1deg;C and monitor the A405nm until the value is constant using a spectrophotometer.
- Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
- Record the increase in A405 nm for 30 minutes at 25°C.
-
Purity
> 95 % SDS-PAGE.
ab79247 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNG TKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAM ANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQ DRPVDDVKIIKAYPSGLEHHHHHH
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.