Recombinant Human papillomavirus HPV18 E7 protein (His tag) (ab236931)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Human papillomavirus HPV18 E7 protein (His tag)
See all HPV18 E7 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human papillomavirus -
Sequence
MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLP ARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPW CASQQ -
Predicted molecular weight
16 kDa including tags -
Amino acids
1 to 105 -
Tags
His tag N-Terminus -
Additional sequence information
Human papillomavirus type 18. N-terminal 6xHis-tagged.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol
Images
-
SDS-PAGE - Recombinant Human papillomavirus HPV18 E7 protein (His tag) (ab236931)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236931.
-
Mass Spectrometry - Recombinant Human papillomavirus HPV18 E7 protein (His tag) (ab236931)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236931 could indicate that this peptide derived from E.coli-expressed Human papillomavirus HPV18 E7.
-
Mass Spectrometry - Recombinant Human papillomavirus HPV18 E7 protein (His tag) (ab236931)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236931 could indicate that this peptide derived from E.coli-expressed Human papillomavirus HPV18 E7.
