Recombinant human KMT5A / SETD8 / Pr-SET7 protein (ab196432)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 84% SDS-PAGE
- Active: Yes
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human KMT5A / SETD8 / Pr-SET7 protein
See all KMT5A / SETD8 / Pr-SET7 proteins and peptides -
Biological activity
50 µl reaction mix (50 mM Tris, pH 8.8, 1 mM EDTA, 1 mM DTT, 40 µM S-adenosylhomocysteine, and 0-6 µg ab196432) is added to the wells coated with the substrate. Incubate for 2 hr. Add antibody against methylated residue of histone H4, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminsecent substrates and read luminescence.
-
Purity
>= 84 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG RLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI EAHPWLKH -
Predicted molecular weight
44 kDa including tags -
Amino acids
195 to 352 -
Tags
GST tag N-Terminus -
Additional sequence information
Genbank accession number: NM_020382
-
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 20% Glycerol (glycerin, glycerine), 0.49% GlutathioneThis product is an active protein and may elicit a biological response in vivo, handle with caution.
Images
-
SDS-PAGE - Recombinant human KMT5A / SETD8 / Pr-SET7 protein (ab196432)
SDS-PAGE analysis of 7.5 μg of ab196432 on a 4-20% SDS-PAGE gel stained with Coomassie.
-
Functional Studies - Recombinant human KMT5A / SETD8 / Pr-SET7 protein (ab196432)Specific activity of ab196432.