Recombinant human IL-6 protein (Animal Free) (ab217414)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
-
Product name
Recombinant human IL-6 protein (Animal Free)
See all IL-6 proteins and peptides -
Biological activity
The ED50 was determined by the dose-dependent stimulation of the proliferation of the IL-6 dependent murine 7TD1 cells is ≤ 0.1 ng/mL, corresponding to a specific activity of ≥ 1 x 107 units/mg.
-
Purity
> 98 % SDS-PAGE.
> 98% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMC ESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEY LQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTK LQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM -
Predicted molecular weight
21 kDa -
Amino acids
29 to 212
-
Preparation and Storage
-
Alternative names
- Interleukin BSF 2
- B cell differentiation factor
- B cell stimulatory factor 2
see all -
Function
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. -
Involvement in disease
Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Post-translational
modificationsN- and O-glycosylated. -
Cellular localization
Secreted. - Information by UniProt
