Recombinant Human IL-5 protein (ab194157)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human IL-5 protein
See all IL-5 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQ GIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYL QEFLGVMNTEWIIESVDHHHHHH -
Predicted molecular weight
14 kDa including tags -
Amino acids
20 to 134 -
Tags
His tag C-Terminus -
Additional sequence information
This product is the mature full length protein from aa 20 to 134. The signal peptide is not included.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab194157 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- B-cell differentiation factor I
- Colony stimulating factor
- EDF
see all -
Function
Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. -
Sequence similarities
Belongs to the IL-5 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab194157 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.