Recombinant Human IL-4 Receptor alpha protein (ab158758)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human IL-4 Receptor alpha protein
See all IL-4 Receptor alpha proteins and peptides -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCI PENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRA PGNLTVHTNV -
Amino acids
26 to 135 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- IL4 binding protein
- IL4 BP
- IL4 Receptor alpha
see all -
Relevance
IL-4 Receptor alpha (IL-4RA) is the alpha chain of the interleukin 4 receptor which binds to both interleukin 4 and interleukin 13 to regulate IgE production, chemokine and mucus production at sites of allergic inflammmation. The IL4 response is involved in promoting Th2 differentiation. The secreted extracellular domain of IL-4R alpha, called sIL4R alpha, can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. It has no signaling abilities. Allelic variations in the IL-4RA gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. -
Cellular localization
Cell membrane; single-pass type I membrane protein. Isoform 2: Secreted protein.
Images
-
SDS-PAGE - Recombinant Human IL-4 Receptor alpha protein (ab158758)ab158758 on a 12.5% SDS-PAGE stained with Coomassie Blue.
