Recombinant Human ICAM5 protein (ab159710)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human ICAM5 protein
See all ICAM5 proteins and peptides -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWL ARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPW -
Amino acids
34 to 131 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- ICAM5 precursor
- Intercellular adhesion molecule 5
- Intercellular adhesion molecule 5 precursor
see all -
Relevance
ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes. It may be a critical component in neuron-microglial cell interactions in the course of normal development or as part of neurodegenerative diseases. -
Cellular localization
Membrane; single-pass type I membrane protein
Images
-
SDS-PAGE - Recombinant Human ICAM5 protein (ab159710)ab159710 on a 12.5% SDS-PAGE stained with Coomassie Blue.