Recombinant Human HSPB7 protein (ab185404)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human HSPB7 protein -
Purity
> 95 % SDS-PAGE.
ab185404 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSD DFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIR ARRHPHTEHVQQTFRTEIKILEHHHHHH -
Predicted molecular weight
19 kDa including tags -
Amino acids
1 to 170 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab185404 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Additional notes
This product was previously labelled as cvHSP
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.24% Tris buffer, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol (glycerin, glycerine)
General Info
-
Alternative names
- Cardiovascular heat shock protein
- cvHsp
- DKFZp779D0968
see all -
Tissue specificity
Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart. -
Sequence similarities
Belongs to the small heat shock protein (HSP20) family. -
Cellular localization
Cytoplasm. Nucleus. Nucleus > Cajal body. Resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab185404 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.24% Tris buffer, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol (glycerin, glycerine)