• Product name

  Recombinant Human Entactin/NID protein
  See all Entactin/NID proteins and peptides

• Expression system

  Wheat germ

• Protein length

  Protein fragment

• Animal free

  No

• Nature

  Recombinant

• • Species

    Human

  • Sequence

    EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYG ITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK

  • Amino acids

    1148 to 1247

  • Tags

    GST tag N-Terminus

• Alternative names

  • Enactin
  • Ent
  • Entactin

  • Entactin 1
  • NID
  • NID 1
  • NID-1
  • Nid1
  • NID1_HUMAN
  • Nidogen
  • Nidogen (enactin)
  • Nidogen 1
  • Nidogen-1

  see all

• Function

  Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.

• Sequence similarities

  Contains 6 EGF-like domains.
  Contains 4 LDL-receptor class B repeats.
  Contains 1 NIDO domain.
  Contains 1 nidogen G2 beta-barrel domain.
  Contains 1 thyroglobulin type-1 domain.

• Post-translational
  modifications

  N- and O-glycosylated.

• Cellular localization

  Secreted > extracellular space > extracellular matrix > basement membrane.

• Target information above from: UniProt accession P14543 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt