Recombinant Human EG-VEGF protein (ab269145)
Key features and details
- Expression system: Escherichia coli
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human EG-VEGF protein
See all EG-VEGF proteins and peptides -
Purity
>95% by SDS-PAGE . -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPF FRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF -
Predicted molecular weight
12 kDa -
Amino acids
20 to 105 -
Additional sequence information
Mature chain
-
Preparation and Storage
-
Alternative names
- Black mamba toxin related protein
- EG VEGF
- EG-VEGF
see all -
Function
Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis. -
Tissue specificity
Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic glands, ovary, testis, adrenal and placenta. -
Sequence similarities
Belongs to the AVIT (prokineticin) family. -
Developmental stage
In adult testis, is strongly expressed only in Leydig cells. In testicular tumors, expressed specifically in Leydig cell tumors (at protein level). Expressed from 14 weeks until birth in fetal testis. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human EG-VEGF protein (ab269145)SDS-PAGE analysis of ab269145 at 1ug/lane under (-) non-reducing and (+) reducing conditions. 4-20% Tris glycine gel. Stained with coomassie blue.