Recombinant human CXCL17/DMC protein (Active) (ab243127)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant human CXCL17/DMC protein (Active)
See all CXCL17/DMC proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/ml, corresponding to a specific activity of >200 IU/mg.
-
Purity
> 98 % SDS-PAGE.
Purity >96% as determined by SDS-PAGE and HPLC. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLP KKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL -
Predicted molecular weight
12 kDa -
Amino acids
22 to 119 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
Specifications
Our Abpromise guarantee covers the use of ab243127 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as CXCL17
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- 13.6 kDa protein
- C-X-C motif chemokine 17
- chemokine (C-X-C motif) ligand 17
see all -
Relevance
Plays a role in angiogenesis and possibly in the development of tumors. May be a housekeeping chemokine regulating recruitment of nonactivated blood monocytes and immature dendritic cells into tissues. May play a role in the innate defense against infections. -
Cellular localization
Secreted.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243127 has not yet been referenced specifically in any publications.
Preparation and Storage
- 13.6 kDa protein
- C-X-C motif chemokine 17
- chemokine (C-X-C motif) ligand 17