Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Adaptive Immunity T Cells Cytotoxic Cells

Recombinant Human CTLA4 protein (ab169909)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 90% SDS-PAGE
  • Tags: His-T7 tag N-Terminus
  • Suitable for: SDS-PAGE

You may also be interested in

Product image
FITC Anti-CD8 alpha antibody [HIT8a] (ab95591)
Product image
Anti-Perforin antibody [PRF1/2468] - BSA and Azide free (ab237888)
Product image
PE Anti-CD226 antibody [DX11] (ab33337)
Product image
Anti-CD226 (phospho S329) antibody (ab61790)

Description

  • Product name

    Recombinant Human CTLA4 protein
    See all CTLA4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab169909 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

    P16410
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFGKAMHVAQPAVVLASSRGIAS FVCEYASPGKATEV RVTVLRQADSQVTEVCAATYMMGNELTFLDDSIC TGTSSGNQVNLTIQGLRAMDTGLYICKVEL MYPPPYYLGIGNGTQIYV IDPEPCPDSD
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      36 to 161
    • Tags

      His-T7 tag N-Terminus

Preparation and Storage

  • Alternative names

    • ALPS5
    • CD
    • CD 152
    • CD152
    • CD152 antigen
    • CD152 isoform
    • Celiac disease 3
    • CELIAC3
    • CTLA 4
    • CTLA-4
    • CTLA4
    • CTLA4_HUMAN
    • Cytotoxic T cell associated 4
    • Cytotoxic T lymphocyte antigen 4
    • Cytotoxic T lymphocyte associated 4
    • Cytotoxic T lymphocyte associated 4, soluble isoform, included
    • Cytotoxic T lymphocyte associated antigen 4
    • Cytotoxic T lymphocyte associated antigen 4 short spliced form
    • Cytotoxic T lymphocyte associated protein 4
    • Cytotoxic T lymphocyte associated serine esterase 4
    • Cytotoxic T lymphocyte protein 4
    • Cytotoxic T-lymphocyte protein 4
    • Cytotoxic T-lymphocyte-associated antigen 4
    • GRD4
    • GSE
    • ICOS
    • IDDM12
    • insulin-dependent diabetes mellitus 12
    • Ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4
    • OTTHUMP00000216623
    see all
  • Function

    Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
  • Tissue specificity

    Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
  • Involvement in disease

    Genetic variation in CTLA4 influences susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
    Note=Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism.
    Genetic variation in CTLA4 is the cause of susceptibility to diabetes mellitus insulin-dependent type 12 (IDDM12) [MIM:601388]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
    Genetic variation in CTLA4 is the cause of susceptibility to celiac disease type 3 (CELIAC3) [MIM:609755]. It is a multifactorial disorder of the small intestine that is influenced by both environmental and genetic factors. It is characterized by malabsorption resulting from inflammatory injury to the mucosa of the small intestine after the ingestion of wheat gluten or related rye and barley proteins. In its classic form, celiac disease is characterized in children by malabsorption and failure to thrive.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylation is important for dimerization.
    Phosphorylation at Tyr-201 prevents binding to the AP-2 adapter complex, blocks endocytosis, and leads to retention of CTLA4 on the cell surface.
  • Cellular localization

    Cell membrane. Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalisation and.
  • Target information above from: UniProt accession P16410 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human CTLA4 protein (ab169909)

  •  
  • Product image

    Recombinant Human CTLA4 protein (Fc Chimera) (Biotin) (ab216225)

    Applications: SDS-PAGE

  •  
  • Recombinant Human CTLA4 protein (Tagged) (ab215591)

    Applications: SDS-PAGE

  •  
  • Product image

    Recombinant human CTLA4 protein (Fc Chimera Active) (ab180054)

    Applications: ELISA, SDS-PAGE

  •  
  • Human CTLA4 peptide (ab215388)

    Applications:

  •  
  • Product image

    Recombinant human CTLA4 protein (Fc Chimera Active) (ab215007)

    Applications: FuncS, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-YANK2 antibody (ab154657)

  •  
  • Product image

    Anti-RAG2 antibody (ab189835)

  •  
  • Product image

    Recombinant human FIST protein (ab85601)

  •  
  • Product image

    Recombinant Human MAFG protein (ab113589)

  •  
  • Product image

    Recombinant Mouse Apolipoprotein A I (ab202174)

  •  
  • Recombinant Human Rad51 protein (ab81943)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.