Recombinant Human CCDC134 protein (ab194049)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: HPLC, SDS-PAGE
-
Product name
Recombinant Human CCDC134 protein
See all CCDC134 proteins and peptides -
Purity
> 95 % SDS-PAGE.
The purity of ab194049 was determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKG LFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRF PRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGIS EKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRI SRSQSELVDHHHHHH -
Predicted molecular weight
25 kDa including tags -
Amino acids
23 to 229 -
Tags
His tag C-Terminus -
Additional sequence information
This product is for the mature full length protein, aa23-229. The signal peptide is not included.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab194049 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Reconstitute for long term storage.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- CC134_HUMAN
- ccdc134
- coiled-coil domain containing 134
see all -
Sequence similarities
Belongs to the UPF0388 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab194049 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Reconstitute for long term storage.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride
Lyophilized from a 0.2 µM filtered solution. -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.