Recombinant Human BTN3A1 protein (Fc Chimera) (ab219670)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human BTN3A1 protein (Fc Chimera)
See all BTN3A1 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVY ADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQ DGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQW SNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGL EKTASISIADPFFRSAQRWIAALAG -
Predicted molecular weight
51 kDa including tags -
Amino acids
30 to 254 -
Additional sequence information
Extracellular domain fused with a human IgG1 Fc tag at the C-terminal.
Specifications
Our Abpromise guarantee covers the use of ab219670 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.75% Glycine, 0.61% Tris buffer, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% -
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- BT3A1_HUMAN
- BTN3A1
- Butyrophilin subfamily 3 member A1
- CD277
-
Tissue specificity
Highly expressed in heart, pancreas and lung, Moderately expressed in placenta, liver and muscle. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 B30.2/SPRY domain.
Contains 2 Ig-like V-type (immunoglobulin-like) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
ab219670 on SDS-PAGE under reducing (R) and non-reducing (NR) conditions.
The gel was stained overnight with Coomassie Blue.
The purity of the protein is greater than 95%.
As a result of glycosylation, the reducing (R) protein migrates as 55 kDa and the non-reducing (NR) protein migrates as 100-120 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab219670 has not yet been referenced specifically in any publications.
Preparation and Storage
- BT3A1_HUMAN
- BTN3A1
- Butyrophilin subfamily 3 member A1
- CD277
Images
-
ab219670 on SDS-PAGE under reducing (R) and non-reducing (NR) conditions.
The gel was stained overnight with Coomassie Blue.
The purity of the protein is greater than 95%.
As a result of glycosylation, the reducing (R) protein migrates as 55 kDa and the non-reducing (NR) protein migrates as 100-120 kDa.