Recombinant human BMP10 protein (ab176078)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
-
Product name
Recombinant human BMP10 protein -
Biological activity
Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 4.0-6.0 ng/ml.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTP TKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGM AVSECGCR -
Predicted molecular weight
24 kDa -
Amino acids
317 to 424 -
Additional sequence information
(Homodimeric disulfide-linked protein consisting of two108 amino acid subunits).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab176078 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.29% Sodium citrate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
General Info
-
Alternative names
- BMP-10
- Bmp10
- BMP10_HUMAN
see all -
Function
Required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Inhibits endothelial cell migration and growth. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab176078 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.29% Sodium citrate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.