Recombinant Human ACRV1 protein (ab151826)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human ACRV1 protein
See all ACRV1 proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab151826 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It was lyophilized from an 0.2 µM filtered solution. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSS EHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSG EHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASG EQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKK IFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI -
Predicted molecular weight
27 kDa including tags -
Amino acids
22 to 265 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151826 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
This product was previously labelled as Intra Acrosomal Protein
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Store at +4°C short term (1-2 weeks). Store at -20°C long term. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionDissolve the lyophilized protein in 1X PBS.
It is not recommended to reconstitute to a concentration less than 100 µg/ml.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- Acrosomal protein SP 10
- Acrosomal protein SP-10
- Acrosomal vesicle protein 1
see all -
Tissue specificity
Testis. -
Cellular localization
Cytoplasmic vesicle > secretory vesicle > acrosome. Nascent acrosomal vesicle of Golgi phase spermatids. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab151826 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Store at +4°C short term (1-2 weeks). Store at -20°C long term. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionDissolve the lyophilized protein in 1X PBS.
It is not recommended to reconstitute to a concentration less than 100 µg/ml.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.