Recombinant Guamerin protein (His tag) (ab241387)
Key features and details
- Expression system: Yeast
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: MS, SDS-PAGE
-
Product name
Recombinant Guamerin protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Sequence
VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGC EYPCTCA -
Predicted molecular weight
8 kDa including tags -
Amino acids
1 to 57 -
Tags
His tag N-Terminus -
Additional sequence information
Hirudo nipponia (Korean blood-sucking leech).
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Guamerin protein (His tag) (ab241387)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241387.
-
Mass Spectrometry - Recombinant Guamerin protein (His tag) (ab241387)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab241387 could indicate that this peptide derived from Yeast-expressed Hirudo nipponia (Korean blood-sucking leech) Guamerin.
-
Mass Spectrometry - Recombinant Guamerin protein (His tag) (ab241387)Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab241387 could indicate that this peptide derived from Yeast-expressed Hirudo nipponia (Korean blood-sucking leech) Guamerin.