Recombinant S. pyogenes 50S ribosomal protein L7/L12 (Tagged) (ab238382)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant S. pyogenes 50S ribosomal protein L7/L12 (Tagged) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Streptococcus pyogenes -
Sequence
MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEA AKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVA AAEAEEIKAKLEEAGATITLK -
Predicted molecular weight
32 kDa including tags -
Amino acids
1 to 121 -
Tags
His tag N-Terminus -
Additional sequence information
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. Serotype M6 (strain ATCC BAA-946 / MGAS10394).
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant S. pyogenes 50S ribosomal protein L7/L12 (Tagged) (ab238382)
ab238382 analyzed by(Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant S. pyogenes 50S ribosomal protein L7/L12 (Tagged) (ab238382)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238382 could indicate that this peptide derived from E.coli-expressed Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) 50S ribosomal protein L7/L12.
-
Mass Spectrometry - Recombinant S. pyogenes 50S ribosomal protein L7/L12 (Tagged) (ab238382)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238382 could indicate that this peptide derived from E.coli-expressed Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) 50S ribosomal protein L7/L12.
