Recombinant Beta-mammal toxin Css4 protein (His tag) (ab225603)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Beta-mammal toxin Css4 protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Centruroides suffusus -
Sequence
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTH LYEQAVVWPLPNKTCN -
Predicted molecular weight
24 kDa including tags -
Amino acids
1 to 66 -
Tags
His tag N-Terminus -
Additional sequence information
6x His-SUMO tag at N-terminus.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis ofab225603 with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225603 could indicate that this peptide derived from E.coli-expressed Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4 protein.
-
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225603 could indicate that this peptide derived from E.coli-expressed Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4 protein.