ProTx-I, CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels. (ab141863)
Key features and details
- Potent, selective CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels.
- CAS Number:
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Thrixopelma pruriens
Overview
-
Product name
ProTx-I, CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels. -
Description
Potent, selective CaV3.1 channel blocker. Inhibits NaV1 and KV2.1 channels. -
Biological description
Potent, selective CaV3.1 channel blocker (IC50 values are 0.2 and 32 μM for CaV3.1 and CaV3.2 respectively). Reversibly inhibits all NaV1 subtypes by modifying gating kinetics similar to ProTx-II (Asc 1880). Blocks KV2.1 channels. Shows proliferative effects. -
Purity
> 98% -
Chemical structure
Properties
-
Molecular weight
3987.50 -
Molecular formula
C171H245N53O47S6 -
Sequence
ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS (Modifications: Disulfide bonds: 2-16, 9-21, 15-28) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Thrixopelma pruriens
-
Research areas