OsK-1, K+ channel blocker (ab141862)
Key features and details
- Potent K+ channel blocker. Toxin.
- CAS Number: 183815-75-0
- Purity: > 98%
- Soluble in water
- Form / State: Solid
- Source: Orthochirus scrobiculosus
Overview
-
Product name
OsK-1, K+ channel blocker -
Description
Potent K+ channel blocker. Toxin. -
Biological description
Potent K+ channel blocker (IC50 values are 0.6, 5.4 nM and 14 pM at Kv1.1, 1.2 and 1.3 respectively). Immunosuppressive agent. Active in vivo and in vitro. -
Purity
> 98% -
CAS Number
183815-75-0 -
Chemical structure
Properties
-
Molecular weight
4205.00 -
Molecular formula
C177H300N56O46S8 -
Sequence
GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK (Modifications: Disulfide bonds: 8-28, 14-33, 18-35) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Orthochirus scrobiculosus
-
Research areas