GLP-1 (7-37), Endogenous active GLP-1r ligand (ab141329)
Key features and details
- Endogenous active GLP-1r ligand
- CAS Number:
- Purity: > 98%
- Soluble in DMSO
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
GLP-1 (7-37), Endogenous active GLP-1r ligand -
Description
Endogenous active GLP-1r ligand -
Biological description
Endogenous active GLP-1r ligand. Increases insulin secretion and decreases glucagon secretion. Promotes insulin sensitivity. Shows antidiabetic effects in vivo. -
Purity
> 98% -
Chemical structure

Properties
-
Molecular weight
3355.67 -
Molecular formula
C151H228N40O47 -
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG -
PubChem identifier
16133830 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in DMSO -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas