Anti-ZNF184 antibody (ab176711)
Key features and details
- Rabbit polyclonal to ZNF184
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ZNF184 antibody -
Description
Rabbit polyclonal to ZNF184 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human ZNF184 aa 1-50 (N terminal). The exact sequence is proprietary. NP_009080.2
Sequence:MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQLDPGQR
Database link: Q99676 -
Positive control
- HeLa, Jurkat, 293T whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7.0-8.0 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-ZNF184 antibody (ab176711) at 0.1 µg/ml
Lane 1 : Jurkat whole cell lysate at 50 µg
Lane 2 : Jurkat whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : 293T cell whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 86 kDa
Exposure time: 30 seconds
-
ZNF184 was immunoprecipitated from 1mg Jurkat whole cell lysate using ab176711 at 6 μg/mg lysate (Lane 1), a rabbit anti-ZNF184 antibobody recognizing a downstream epitope (Lane 2) and control IgG (Lane 3). 20% of Immunoprecipitate was loaded per lane and blotted using ab176711 at 1 μg/ml.
.
Detection:
Chemiluminescence with exposure times of 10 seconds.

