Anti-UBXD8 antibody (ab96673)
Key features and details
- Rabbit polyclonal to UBXD8
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-UBXD8 antibody
See all UBXD8 primary antibodies -
Description
Rabbit polyclonal to UBXD8 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide corresponding to Human UBXD8 aa 383-445.
Sequence:SLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLS HTEVLFVQDLTDE
Database link: NP_055428 -
Positive control
- WB: H1299 and HeLa cel lysates. IHC-P: Mouse intestine tissue. ICC/IF: HeLa cells.
-
General notes
This product was previously labelled as ETEA
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-UBXD8 antibody (ab96673) at 1/1000 dilution
Lane 1 : H1299 whole cell lysate
Lane 2 : HeLa whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 53 kDa
10% SDS PAGE -
4% paraformaldehyde-fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling UBXD8 using ab96673 at 1/500 dilution (green) in ICC/IF. The nuclear counter stain is Hoechst 33343 (blue).
-
Paraffin-embedded mouse intestine tissue labeling UBXD8 using ab96673 at1/500 dilution in immunohistochemical analysis.
Antigen retrieval: EDTA-based (pH8.0), 15 minutes.