Anti-TTI2 antibody - C-terminal (ab176698)
Key features and details
- Rabbit polyclonal to TTI2 - C-terminal
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TTI2 antibody - C-terminal
See all TTI2 primary antibodies -
Description
Rabbit polyclonal to TTI2 - C-terminal -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human TTI2 aa 458-508 (C terminal). The exact sequence is proprietary. (NP_079391.2).
Sequence:ATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVVNYIRKVQQVSEGAPYN
Database link: Q6NXR4 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
This product was previously labelled as C8ORF41
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-TTI2 antibody - C-terminal (ab176698)All lanes : Anti-TTI2 antibody - C-terminal (ab176698) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa
Exposure time: 3 minutes
-
Immunoprecipitation - Anti-TTI2 antibody - C-terminal (ab176698)Immunoprecipitation. ab176698 at 1 µg/ml staining TTI2 in HeLa whole cell lysate immunoprecipitated using ab176698 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
Lane 2: control IgG.
