Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Growth Factors/Hormones Hormones

Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)

Price and availability

284 784 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Thyroid Hormone Receptor beta - N-terminal
  • Suitable for: WB, ICC/IF
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Anti-Somatostatin Receptor 2 antibody (ab9550)
Product image
Anti-TSH Receptor/TSH-R antibody [EPR19751] (ab218108)
Calcitonin (human), bone resorption inhibitor (ab142264)
Product image
Recombinant Human Cholecystokinin protein (ab158040)

Overview

  • Product name

    Anti-Thyroid Hormone Receptor beta antibody - N-terminal
    See all Thyroid Hormone Receptor beta primary antibodies
  • Description

    Rabbit polyclonal to Thyroid Hormone Receptor beta - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep
  • Immunogen

    Recombinant fragment corresponding to Human Thyroid Hormone Receptor beta 1 aa 1-250 (N terminal).
    Sequence:

    MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK NEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSY LDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGK CVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRR REELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDI


    Database link: P10828
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HepG2 and U-87MG cell lysates. Mouse liver and eye tissue lysates. Rat liver and eye tissue lysates. ICC/ IF: U-2 OS.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Growth Factors/Hormones
    • Hormones
    • Neuroscience
    • Endocrine system
    • Thyroid axis

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)
    Immunocytochemistry/ Immunofluorescence - Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)

    Immunofluorescence staining of U-2 OS cells stained for Thyroid Hormone Receptor beta with ab180612 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).

  • Western blot - Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)
    Western blot - Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)
    All lanes : Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612) at 1/1000 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : U-87MG cell lysate
    Lane 3 : Mouse liver tissue lysate
    Lane 4 : Mouse eye tissue lysate
    Lane 5 : Rat liver tissue lysate
    Lane 6 : Rat eye tissue lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat AntiRabbit IgG (H+L)

    Developed using the ECL technique.

    Predicted band size: 53 kDa


    Exposure time: 30 seconds


    Blocking buffer: 3% nonfat dry milk in TBST

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab180612)

  •  
  • Product image

    Anti-Thyroid Hormone Receptor beta antibody (ab53170)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Thyroid Hormone Receptor beta antibody (ab15545)

    Applications: IHC-P

  •  
  • Product image

    Anti-Thyroid Hormone Receptor beta antibody (ab5622)

    Applications: ICC/IF, IHC-P

  •  
  • Product image

    Anti-Thyroid Hormone Receptor beta antibody (ab155297)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Thyroid Hormone Receptor beta antibody - N-terminal (ab196484)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-STAT5a (phospho Y694) antibody [6HCLC] (ab277762)

  •  
  • Product image

    Anti-ENO1 antibody [253] - N-terminal (ab190365)

  •  
  • Product image

    Anti-FAM111A antibody - N-terminal (ab200718)

  •  
  • Product image

    Anti-SNAIL + SLUG (phospho S246) antibody (ab63568)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.