Astana Biomed Group, an authorized Abcam distributor in Central Asia

Anti-TDP43 antibody [2E2-D3] (ab57105)

Key features and details

  • Mouse monoclonal [2E2-D3] to TDP43
  • Suitable for: Flow Cyt, WB, ICC/IF, IHC-P, Sandwich ELISA
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

Overview

  • Product name

    Anti-TDP43 antibody [2E2-D3]
    See all TDP43 primary antibodies

  • Description

    Mouse monoclonal [2E2-D3] to TDP43

  • Host species

    Mouse

  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    sELISA
    Recombinant fragment
    WB
    Human
    See all applications and species data

  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human TDP43 aa 1-261. The molecular weight of GST-tag is 26kDa.
    Sequence:

    MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC MRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAV QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTE DMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLII KGISVHISNA


    Database link: Q13148
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • General notes

    This product was changed from ascites to tissue culture supernatant on 5/3/19. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TDP43 antibody [2E2-D3] (ab57105)

    ab57105 staining TDP43 in human leiomyosarcoma tissue. Antibody concentration 3µg/ml.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

    TDP43 antibody (ab57105) at 1ug/lane + A-431 cell lysate at 25ug/lane.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

    ab57105 staining TDP43 in HeLa cells. Antibody concentration 10µg/ml.

    This image was generated using the ascites version of the product.

     

     

  • Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Sandwich ELISA - Anti-TDP43 antibody [2E2-D3] (ab57105)

    Detection limit for recombinant GST tagged TDP43 is 0.3 ng/ml as a capture antibody.

    This image was generated using the ascites version of the product.

     

  • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)

    ab57105 staining TDP43 overexpressed in the HEK293 cell line (cotransfected with TDP43 validated Chimera siRNA) (lane 1) or non-tranfected control (lane 2).

    GAPDH used as a specificity and loading control.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Flow Cytometry - Anti-TDP43 antibody [2E2-D3] (ab57105)

    Overlay histogram showing HeLa cells stained with ab57105 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab57105, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
    This image was generated using the ascites version of the product.

  • Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Western blot - Anti-TDP43 antibody [2E2-D3] (ab57105)
    All lanes : Anti-TDP43 antibody [2E2-D3] (ab57105) at 5 µg/ml

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with TDP43, cell lysate
    Lane 2 : Untransfected HEK-293T cell lysate

    Developed using the ECL technique.


    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)
    Immunocytochemistry/ Immunofluorescence - Anti-TDP43 antibody [2E2-D3] (ab57105)

    TARDBP antibody (ab57105) used in immunofluorescence at 10ug/ml on HeLa cells.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-TDP43 antibody [2E2-D3] (ab57105)

© 2021 Astana Biomed Group LLP. All rights reserved.