Anti-TBC1D2 antibody - N-terminal (ab176701)
Key features and details
- Rabbit polyclonal to TBC1D2 - N-terminal
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TBC1D2 antibody - N-terminal
See all TBC1D2 primary antibodies -
Description
Rabbit polyclonal to TBC1D2 - N-terminal -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human TBC1D2 aa 1-50 (N terminal). The exact sequence is proprietary.
Sequence:MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCG
Database link: Q9BYX2 -
Positive control
- Recombinant Human TBC1D2 protein (ab163081) can be used as a positive control in WB. HeLa, 293T and Jurkat whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-TBC1D2 antibody - N-terminal (ab176701) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 105 kDa
Exposure time: 30 seconds
-
Detection of TBC1D2 by Western Blot of Immunprecipitate.
Western blot using ab176701 at 0.4 µg/ml staining TBC1D2 in HeLa whole cell lysate immunoprecipitated using ab176701 at 6 µg/mg lysate (1 mg/IP; 20% of IP loaded/lane).
Detection: Chemiluminescence with exposure times of 3 seconds

