Anti-ST3GAL4/STZ antibody (ab87114)
Key features and details
- Rabbit polyclonal to ST3GAL4/STZ
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ST3GAL4/STZ antibody
See all ST3GAL4/STZ primary antibodies -
Description
Rabbit polyclonal to ST3GAL4/STZ -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Dog -
Immunogen
Synthetic peptide corresponding to Human ST3GAL4/STZ aa 252-301 (internal sequence).
Sequence:KQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMA
Database link: NP_006269 -
Positive control
- WB: HeLa, 293T, 786-0 and 721_B cell lysates.
-
General notes
Previously labelled as ST3GAL4.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: PBS, 2% Sucrose -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-ST3GAL4/STZ antibody (ab87114) at 3 µg/ml
Lane 1 : HeLa cell lysate
Lane 2 : 293T cell lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : RP conjugated anti Rabbit IgG at 1/15000 dilution
Predicted band size: 38 kDa
Additional bands at: 38 kDa (possible non-specific secondary antibody binding)
-
Anti-ST3GAL4/STZ antibody (ab87114) at 1 µg/ml + 786-0 cell lysate
Secondary
HRP conjugated anti Rabbit IgG at 1/15000 dilution
Predicted band size: 38 kDa
Observed band size: 38 kDa
-
Anti-ST3GAL4/STZ antibody (ab87114) at 1 µg/ml + Human HeLa cell lysate
Secondary
HRP conjugated anti Rabbit IgG at 1/15000 dilution
Predicted band size: 38 kDa
Observed band size: ~40 kDa why is the actual band size different from the predicted?
-
Anti-ST3GAL4/STZ antibody (ab87114) at 1 µg/ml + 721_B cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 38 kDa
Observed band size: ~38 kDa why is the actual band size different from the predicted?