Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Amino Acids

Anti-ST3GAL4/STZ antibody (ab87114)

Anti-ST3GAL4/STZ antibody (ab87114)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to ST3GAL4/STZ
  • Suitable for: WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Indoleamine 2, 3-dioxygenase antibody (ab217303)
Product image
Recombinant Human SLC7A9 protein (ab161312)
Product image
Anti-SLC22A4/ETT antibody (ab244462)
Product image
Anti-PYCR1 antibody (ab206693)

Overview

  • Product name

    Anti-ST3GAL4/STZ antibody
    See all ST3GAL4/STZ primary antibodies
  • Description

    Rabbit polyclonal to ST3GAL4/STZ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ST3GAL4/STZ aa 252-301 (internal sequence).
    Sequence:

    KQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMA


    Database link: NP_006269
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HeLa, 293T, 786-0 and 721_B cell lysates.
  • General notes

    Previously labelled as ST3GAL4.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Amino Acids
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Amino acid metabolism
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    All lanes : Anti-ST3GAL4/STZ antibody (ab87114) at 3 µg/ml

    Lane 1 : HeLa cell lysate
    Lane 2 : 293T cell lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : RP conjugated anti Rabbit IgG at 1/15000 dilution

    Predicted band size: 38 kDa
    Additional bands at: 38 kDa (possible non-specific secondary antibody binding)

  • Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Anti-ST3GAL4/STZ antibody (ab87114) at 1 µg/ml + 786-0 cell lysate

    Secondary
    HRP conjugated anti Rabbit IgG at 1/15000 dilution

    Predicted band size: 38 kDa
    Observed band size: 38 kDa

  • Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Anti-ST3GAL4/STZ antibody (ab87114) at 1 µg/ml + Human HeLa cell lysate

    Secondary
    HRP conjugated anti Rabbit IgG at 1/15000 dilution

    Predicted band size: 38 kDa
    Observed band size: ~40 kDa
    why is the actual band size different from the predicted?

  • Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Western blot - Anti-ST3GAL4/STZ antibody (ab87114)
    Anti-ST3GAL4/STZ antibody (ab87114) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa
    Observed band size: ~38 kDa why is the actual band size different from the predicted?

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-ST3GAL4/STZ antibody (ab87114)

  •  
  • Product image

    Anti-ST3GAL4/STZ antibody (ab238742)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CD62L antibody [DREG-56] (ab254540)

  •  
  • Product image

    Anti-Cre recombinase antibody (ab216262)

  •  
  • Product image

    Anti-Proteasome 20S beta 6 antibody (ab3331)

  •  
  • Product image

    Anti-NPR-C antibody - C-terminal (ab174706)

  •  
  • Product image

    Anti-DELE antibody - N-terminal (ab189958)

  •  
  • Product image

    Anti-ZFAND3 antibody (ab230485)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.