Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microfilaments Actin etc Actin Assembly

Anti-Spir-1 antibody (ab130403)

Anti-Spir-1 antibody (ab130403)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Spir-1
  • Suitable for: ICC/IF, WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-PDPK1 (phospho S410) antibody [EPR6157] - BSA and Azide free (ab248507)
Product image
Human INPP5K (SKIP) knockout HeLa cell lysate (ab258470)
Product image
Anti-ROCK1 antibody - N-terminal (ab156284)
Product image
Anti-DOCK2 antibody (ab204372)

Overview

  • Product name

    Anti-Spir-1 antibody
  • Description

    Rabbit polyclonal to Spir-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Spir-1 aa 374-474. This sequence can be found also in Isoforms 3 and 4, but not in Isoform 1.
    Sequence:

    LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKE NGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK


    Database link: Q08AE8-2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: RT4 and U-251 MG whole cell lysates; IHC-P: Human lateral ventricle tissue; ICC: U-2 OS whole cells.
  • General notes

    Store product undiluted. For continuous use, store at 2-8°C for one-two days. Working dilution samples should be discarded if not used within 12 hours. The antibody solution should be gently mixed before use.
    This antibody is mono-specific.

    Previously labelled as SPIRE1. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cytoskeleton
    • Microfilaments
    • Actin etc
    • Actin Assembly

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Spir-1 antibody (ab130403)
    Immunocytochemistry/ Immunofluorescence - Anti-Spir-1 antibody (ab130403)

    Immunocytochemical analysis of U-2 OS (Human bone osteosarcoma epithelial cell line) whole cells labeling Spir-1 in the nucleoplasm and cytosol with ab130403 antibody at 2 µg/ml.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Spir-1 antibody (ab130403)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Spir-1 antibody (ab130403)

    Immunohistochemical analysis of paraffin embedded human lateral ventricle tissue labeling Spir-1 in the nucleus of neuronal cells with ab130403 antibody at a 1/500 dilution.

    Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

  • Western blot - Anti-Spir-1 antibody (ab130403)
    Western blot - Anti-Spir-1 antibody (ab130403)
    All lanes : Anti-Spir-1 antibody (ab130403) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate

    Predicted band size: 86 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-BAP31 antibody (ab237485)

  •  
  • Product image

    Anti-Ago1 antibody [OTI4G1] (ab279392)

  •  
  • Product image

    Anti-Calnexin antibody (ab13505)

  •  
  • Product image

    Anti-ROX antibody (ab126282)

  •  
  • Product image

    Anti-FLJ30934 antibody (ab230112)

  •  
  • Product image

    Anti-Golgin-245 antibody (ab122250)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.