Anti-Spir-1 antibody (ab130403)
Key features and details
- Rabbit polyclonal to Spir-1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Spir-1 antibody -
Description
Rabbit polyclonal to Spir-1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Spir-1 aa 374-474. This sequence can be found also in Isoforms 3 and 4, but not in Isoform 1.
Sequence:LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKE NGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK
Database link: Q08AE8-2 -
Positive control
- WB: RT4 and U-251 MG whole cell lysates; IHC-P: Human lateral ventricle tissue; ICC: U-2 OS whole cells.
-
General notes
Store product undiluted. For continuous use, store at 2-8°C for one-two days. Working dilution samples should be discarded if not used within 12 hours. The antibody solution should be gently mixed before use.
This antibody is mono-specific.Previously labelled as SPIRE1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Spir-1 antibody (ab130403)
Immunocytochemical analysis of U-2 OS (Human bone osteosarcoma epithelial cell line) whole cells labeling Spir-1 in the nucleoplasm and cytosol with ab130403 antibody at 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Spir-1 antibody (ab130403)Immunohistochemical analysis of paraffin embedded human lateral ventricle tissue labeling Spir-1 in the nucleus of neuronal cells with ab130403 antibody at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Western blot - Anti-Spir-1 antibody (ab130403)All lanes : Anti-Spir-1 antibody (ab130403) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate
Predicted band size: 86 kDa