Anti-SLC25A11 antibody (ab155196)
Key features and details
- Rabbit polyclonal to SLC25A11
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SLC25A11 antibody
See all SLC25A11 primary antibodies -
Description
Rabbit polyclonal to SLC25A11 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Xenopus tropicalis
-
Immunogen
Recombinant fragment corresponding to Human SLC25A11 aa 92-314.
Sequence:ATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAE VALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARA VVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD IAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLPH TVLTFIFLEQMNKAYKRLFLSG
-
Positive control
- Jurkat, Raji whole cell lysate; U87 xenograft
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 79.99% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-SLC25A11 antibody (ab155196) at 1/5000 dilution
Lane 1 : Jurkat whole cell lysate
Lane 2 : Raji whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 34 kDa
12% SDS PAGE -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLC25A11 antibody (ab155196)Immunohistochemical analysis of paraffin-embedded U87 xenograft tissue labeling SLC25A11 with ab155196 at 1/500 dilution.

