Anti-SHOX2 antibody (ab55740)
Key features and details
- Mouse monoclonal [1D1] to SHOX2
- Suitable for: WB, IHC-Fr
- Reacts with: Rat, Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-SHOX2 antibody [1D1]
See all SHOX2 primary antibodies -
Description
Mouse monoclonal [1D1] to SHOX2 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Frmore details -
Species reactivity
Reacts with: Rat, Human, Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human SHOX2 aa 117-204.
Sequence:SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPD AFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Database link: O60902 -
Positive control
- WB: Human liver tissue lysat; PC-12 cell lysate
-
General notes
This product was changed from ascites to tissue culture supernatant on 16/Oct/2019. Lot numbers higher than GR3303529 are from tissue culture supernatant. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
1D1 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Western blot - Anti-SHOX2 antibody (ab55740)Anti-SHOX2 antibody (ab55740) + Recombinant SHOX2 Protein.
Predicted band size: 35 kDaThis image was generated using the ascites version of the product.
-
Western blot - Anti-SHOX2 antibody (ab55740)SHOX2 antibody (ab55740) at 1ug/lane + PC-12 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
