Anti-RPS14 antibody (ab174661)
Key features and details
- Rabbit polyclonal to RPS14
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-RPS14 antibody
See all RPS14 primary antibodies -
Description
Rabbit polyclonal to RPS14 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Chicken, Turkey, Xenopus laevis, Drosophila melanogaster, Zebrafish, Xenopus tropicalis -
Immunogen
Synthetic peptide within Human RPS14 aa 101-151. The exact sequence is proprietary. NP_001020242.1
Sequence:GGNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRR L
Database link: P62263 -
Positive control
- Whole cell lysate from 293T, HeLa, Jurkat, Mouse TCMK-1 and Mouse NIH3T3 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of RPS14 by Western Blot of Immunoprecipitate.
-
All lanes : Anti-RPS14 antibody (ab174661) at 0.100000001490116 µg/ml
Lane 1 : 293T whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : Mouse TCMK-1 whole cell lysate
Lane 5 : Mouse NIH3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Exposure time: 3 minutes