Anti-PRR11 antibody [OTI1A4] (ab131652)
Key features and details
- Mouse monoclonal [OTI1A4] to PRR11
- Suitable for: WB
- Reacts with: Mouse, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-PRR11 antibody [OTI1A4]
See all PRR11 primary antibodies -
Description
Mouse monoclonal [OTI1A4] to PRR11 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Dog, Human, African green monkey -
Immunogen
Recombinant fragment corresponding to Human PRR11 aa 125-360. (NP_060774) produced in E.coli.
Sequence:MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSID ISQSRSWLTSSWNFNFPNIRDAIKLWTNRVWSIYSWCQNCITQSLEVLKD TIFPSRICHRELYSVKQQFCILESKLCKLQEALKTISESSSCPSCGQTCH MSGKLTNVPACVLITPGDSKAVLPPTLPQPASHFPPPPPPPPLPPPPPPL APVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLI PSPKARNPLVTVSDLQHVTLKPNSKVLSTRVTNVLITPGKSQMDLRKLLR KVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLP LSTSSFDEQN
Database link: Q96HE9 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY PRR11 cDNA; HepG2, HeLa, SVT2, A549, COS-7, jurkat, MDCK, PC-12 and MCF7 whole cell lysate.
-
General notes
The clone number has been updated from 1A4 to OTI1A4, both clone numbers name the same clone.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI1A4 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-PRR11 antibody [OTI1A4] (ab131652) at 1/2000 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 3 : SVT2 whole cell lysate
Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) whole cell lysate
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
Lane 7 : MDCK whole cell lysate
Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate
Lane 9 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Predicted band size: 40 kDa
-
All lanes : Anti-PRR11 antibody [OTI1A4] (ab131652)
Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK293T cells transfected with pCMV6-ENTRY PRR11 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 40 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC201889)