Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Enzymes Other Enzymes

Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)

Price and availability

274 732 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [5B2E5] to PAPLN/Papilin
  • Suitable for: ICC/IF, WB
  • Reacts with: Mouse, Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-PCPE-2 antibody (ab228739)
Product image
Anti-TLL1 antibody (ab167664)
Product image
Recombinant Human LOXL2 protein (Fc Chimera) (ab221204)
Product image
Human LOXL2 knockout HeLa cell pellet (ab279227)

Overview

  • Product name

    Anti-PAPLN/Papilin antibody [5B2E5]
  • Description

    Mouse monoclonal [5B2E5] to PAPLN/Papilin
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human PAPLN/Papilin aa 766-870. Expressed in E. Coli.
    Sequence:

    WAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQ PGASGRSTHTDGGGSSPAGEQEPSQHRTGAAVQRKPWPSGGLWRQDQQPG PGEAP


    Database link: O95428
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human PAPLN/Papilin recombinant protein; HEK293 cell lysate, transfected with PAPLN/Papilin (amino acids 766-870)-IgGFc; HeLa, HepG2, OCM-1, Raji, Jurkat and mouse NIH 3T3 cell lysates; Mouse NIH 3T3 cells.
  • General notes

     This product was previously labelled as PAPLN

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    5B2E5
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • ECM Enzymes
    • Other Enzymes
    • Cell Biology
    • Proteolysis / Ubiquitin
    • Protease inhibitors
    • Other protease inhibitors

Images

  • Western blot - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    Western blot - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    Anti-PAPLN/Papilin antibody [5B2E5] (ab181788) at 1/500 dilution + Human PAPLN/Papilin recombinant protein

    Predicted band size: 138 kDa

  • Western blot - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    Western blot - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    All lanes : Anti-PAPLN/Papilin antibody [5B2E5] (ab181788) at 1/500 dilution

    Lane 1 : HEK293 cell lysate, non-transfected
    Lane 2 : HEK293 cell lysate, transfected with PAPLN/Papilin (amino acids 766-870)-hIgGFc

    Predicted band size: 138 kDa

  • Western blot - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    Western blot - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    All lanes : Anti-PAPLN/Papilin antibody [5B2E5] (ab181788) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : OCM-1 cell lysate
    Lane 4 : Raji cell lysate
    Lane 5 : Jurkat cell lysate
    Lane 6 : mouse NIH 3T3 cell lysate

    Predicted band size: 138 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
    Immunocytochemistry/ Immunofluorescence - Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)

    Immunofluorescent analysis of mouse NIH 3T3 cells labeling PAPLN/Papilin with ab181788 at 1/200 dilution (green).  Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Rad51 antibody [51RAD01] (ab1837)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.