Anti-PAPLN/Papilin antibody [5B2E5] (ab181788)
Key features and details
- Mouse monoclonal [5B2E5] to PAPLN/Papilin
- Suitable for: ICC/IF, WB
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-PAPLN/Papilin antibody [5B2E5] -
Description
Mouse monoclonal [5B2E5] to PAPLN/Papilin -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human PAPLN/Papilin aa 766-870. Expressed in E. Coli.
Sequence:WAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQ PGASGRSTHTDGGGSSPAGEQEPSQHRTGAAVQRKPWPSGGLWRQDQQPG PGEAP
Database link: O95428 -
Positive control
- Human PAPLN/Papilin recombinant protein; HEK293 cell lysate, transfected with PAPLN/Papilin (amino acids 766-870)-IgGFc; HeLa, HepG2, OCM-1, Raji, Jurkat and mouse NIH 3T3 cell lysates; Mouse NIH 3T3 cells.
-
General notes
This product was previously labelled as PAPLN
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
5B2E5 -
Isotype
IgG1 -
Research areas
Images
-
Anti-PAPLN/Papilin antibody [5B2E5] (ab181788) at 1/500 dilution + Human PAPLN/Papilin recombinant protein
Predicted band size: 138 kDa
-
All lanes : Anti-PAPLN/Papilin antibody [5B2E5] (ab181788) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with PAPLN/Papilin (amino acids 766-870)-hIgGFc
Predicted band size: 138 kDa
-
All lanes : Anti-PAPLN/Papilin antibody [5B2E5] (ab181788) at 1/500 dilution
Lane 1 : HeLa cell lysate
Lane 2 : HepG2 cell lysate
Lane 3 : OCM-1 cell lysate
Lane 4 : Raji cell lysate
Lane 5 : Jurkat cell lysate
Lane 6 : mouse NIH 3T3 cell lysate
Predicted band size: 138 kDa
-
Immunofluorescent analysis of mouse NIH 3T3 cells labeling PAPLN/Papilin with ab181788 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.