Anti-OCM antibody (ab150947)
Key features and details
- Rabbit polyclonal to OCM
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-OCM antibody -
Description
Rabbit polyclonal to OCM -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P Human
-
Immunogen
Recombinant fragment corresponding to Human OCM aa 1-41.
Sequence:MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSA
-
Positive control
- IHC-P: Human testis and cerebellum tissues.
-
General notes
This product was previously labelled as oncomodulin
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-OCM antibody (ab150947)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling OCM with ab150947 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-OCM antibody (ab150947)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebellum tissue labelling OCM with ab150947 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-OCM antibody (ab150947)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling OCM with ab150947 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.