Anti-MYLK3/MLCK antibody - C-terminal (ab177358)
Key features and details
- Rabbit polyclonal to MYLK3/MLCK - C-terminal
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MYLK3/MLCK antibody - C-terminal
See all MYLK3/MLCK primary antibodies -
Description
Rabbit polyclonal to MYLK3/MLCK - C-terminal -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species WB Human -
Immunogen
Synthetic peptide within Human MYLK3/MLCK aa 751-800 (C terminal). The exact sequence is proprietary. (NP_872299).
Sequence:LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK
Database link: Q32MK0 -
Positive control
- WB: HepG2 and HeLa whole cell lysates.
-
General notes
Protein previously labeled as MYLK3.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-MYLK3/MLCK antibody - C-terminal (ab177358) at 1 µg/ml + HepG2 whole cell lysate at 10 µg with Milk at 5 %
Predicted band size: 88 kDaWestern blot analysis labelling MYLK3 with ab177358.
-
All lanes : Anti-MYLK3/MLCK antibody - C-terminal (ab177358) at 1 µg/ml
Lane 1 : HeLa cell lysate with Milk
Lane 2 : Human placenta tissue lysate with Milk
Lysates/proteins at 25 µg per lane.
Blocking peptides at 5 % per lane.
Predicted band size: 88 kDaWestern blot analysis labelling MYLK3 with ab177358.

