Anti-MEK1 antibody [OTI4E1] (ab139343)
Key features and details
- Mouse monoclonal [OTI4E1] to MEK1
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-MEK1 antibody [OTI4E1]
See all MEK1 primary antibodies -
Description
Mouse monoclonal [OTI4E1] to MEK1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF African green monkeyIHC-P HumanWB Human -
Immunogen
Recombinant full length protein corresponding to Human MEK1 aa 1-393.
Sequence:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRL EAFLTQKQKVGELKDDDFEK ISELGAGNGGVVFKVSHKPSGLVMARKL IHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEIS ICMEHM DGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNI LVNSRGEIKLCDFG VSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQS DIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVE GDAAETPPRPRT PGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCL IKNPAERA DLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHA AGV
Database link: NP_002746 -
Positive control
- WB: HEK293T cells transfected with the pCMV6-ENTRY MEK1 cDNA; COS7 cells transiently transfected by pCMV6-ENTRY MEK1 cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; IHC-P: Human breast adenocarcinoma, Human kidney, Human ovary Adenocarcinoma, Human pancreas, Human endometrium and Human tonsil tissues. ICC/IF: COS7 cells transiently transfected by pCMV6-ENTRY MAP2K1
-
General notes
The clone number has been updated from 4E1 to OTI4E1, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI4E1 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution
Lane 1 : HepG2 cell extract (Human).
Lane 2 : HeLa cell extract (Human).
Lane 3 : SVT2 cell extract (Mouse).
Lane 4 : A549 cell extract (Human)
Lane 5 : COS7 cell extract (Monkey).
Lane 6 : Jurkat cell extract (Human).
Lane 7 : MDCK cell extract (Canine).
Lane 8 : PC12 cell extract (Rat).
Lane 9 : MCF7 cell extract (Human).
Lysates/proteins at 35 µg per lane.
Predicted band size: 43 kDa
-
All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution
Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control cDNA.
Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY MEK1 cDNA.
Lysates/proteins at 5 µg per lane.
Predicted band size: 43 kDa
-
All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution
Lane 1 : Human testis extract
Lane 2 : Human uterus extract
Lane 3 : Human breast extract
Lane 4 : Human brain extract
Lane 5 : Human liver extract
Lane 6 : Human ovary extract
Lane 7 : Human thyroid gland extract
Lane 8 : Human colon extract
Lysates/proteins at 10 µg per lane.
Predicted band size: 43 kDa
-
immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY MEK cDNA, labelling MEK1 with ab139343 at 1/100 dilution.
-
Immunohistochemical staining of paraffin-embedded Human breast tissue adenocarcinoma labelling MEK1 with ab139343 at 1/150 dilution.
-
Immunohistochemical staining of paraffin-embedded Human Kidney tissue labelling MEK1 with ab139343 at 1/150 dilution.
-
Immunohistochemical staining of paraffin-embedded Human ovary adenocarcinoma tissue labelling MEK1 with ab139343 at 1/150 dilution.
-
Immunohistochemical staining of paraffin-embedded Human pancreas tissue labelling MEK1 with ab139343 at 1/150 dilution.
-
Immunohistochemical staining of paraffin-embedded Human endometrium tissue labelling MEK1 with ab139343 at 1/150 dilution.
-
Immunohistochemical staining of paraffin-embedded Human tonsil labelling MEK1 with ab139343 at 1/150 dilution.