Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-MEK1 antibody [OTI4E1] (ab139343)

Anti-MEK1 antibody [OTI4E1] (ab139343)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI4E1] to MEK1
  • Suitable for: WB, IHC-P, ICC/IF
  • Reacts with: Mouse, Rat, Dog, Human, African green monkey
  • Isotype: IgG1

You may also be interested in

Recombinant human Renin protein (ab183267)
Product image
Anti-B7H4 antibody [BLR043F] (ab243899)
Product image
Recombinant rhesus monkey IGFBP1 protein (His tag) (ab219692)
Product image
Anti-RG9MTD1 antibody - C-terminal (ab190262)

Overview

  • Product name

    Anti-MEK1 antibody [OTI4E1]
    See all MEK1 primary antibodies
  • Description

    Mouse monoclonal [OTI4E1] to MEK1
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    ICC/IF
    African green monkey
    IHC-P
    Human
    WB
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human MEK1 aa 1-393.
    Sequence:

    MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRL EAFLTQKQKVGELKDDDFEK ISELGAGNGGVVFKVSHKPSGLVMARKL IHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEIS ICMEHM DGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNI LVNSRGEIKLCDFG VSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQS DIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVE GDAAETPPRPRT PGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCL IKNPAERA DLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHA AGV


    Database link: NP_002746
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK293T cells transfected with the pCMV6-ENTRY MEK1 cDNA; COS7 cells transiently transfected by pCMV6-ENTRY MEK1 cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; IHC-P: Human breast adenocarcinoma, Human kidney, Human ovary Adenocarcinoma, Human pancreas, Human endometrium and Human tonsil tissues. ICC/IF: COS7 cells transiently transfected by pCMV6-ENTRY MAP2K1
  • General notes

    The clone number has been updated from 4E1 to OTI4E1, both clone numbers name the same clone.

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 1% BSA, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography
  • Clonality

    Monoclonal
  • Clone number

    OTI4E1
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Protein Phosphorylation
    • Tyrosine Kinases
    • Other
    • Signal Transduction
    • Protein Phosphorylation
    • Ser / Thr Kinases
    • MAPK Pathway

Images

  • Western blot - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Western blot - Anti-MEK1 antibody [OTI4E1] (ab139343)
    All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution

    Lane 1 : HepG2 cell extract (Human).
    Lane 2 : HeLa cell extract (Human).
    Lane 3 : SVT2 cell extract (Mouse).
    Lane 4 : A549 cell extract (Human)
    Lane 5 : COS7 cell extract (Monkey).
    Lane 6 : Jurkat cell extract (Human).
    Lane 7 : MDCK cell extract (Canine).
    Lane 8 : PC12 cell extract (Rat).
    Lane 9 : MCF7 cell extract (Human).

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 43 kDa

  • Western blot - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Western blot - Anti-MEK1 antibody [OTI4E1] (ab139343)
    All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control cDNA.
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY MEK1 cDNA.

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 43 kDa

  • Western blot - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Western blot - Anti-MEK1 antibody [OTI4E1] (ab139343)
    All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human uterus extract
    Lane 3 : Human breast extract
    Lane 4 : Human brain extract
    Lane 5 : Human liver extract
    Lane 6 : Human ovary extract
    Lane 7 : Human thyroid gland extract
    Lane 8 : Human colon extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 43 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunocytochemistry/ Immunofluorescence - Anti-MEK1 antibody [OTI4E1] (ab139343)
    immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY MEK cDNA, labelling MEK1 with ab139343 at 1/100 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemical staining of paraffin-embedded Human breast tissue adenocarcinoma labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemical staining of paraffin-embedded Human Kidney tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemical staining of paraffin-embedded Human ovary adenocarcinoma tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemical staining of paraffin-embedded Human pancreas tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemical staining of paraffin-embedded Human endometrium tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MEK1 antibody [OTI4E1] (ab139343)
    Immunohistochemical staining of paraffin-embedded Human tonsil labelling MEK1 with ab139343 at 1/150 dilution.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-MEK1 antibody [OTI4E1] (ab139343)

  •  
  • Product image

    Anti-MEK1 antibody [Y77] (ab32576)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-MEK1 antibody [Y77] - BSA and Azide free (ab167151)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-MEK1 antibody [E342] (ab193986)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-MEK1 (phospho S298) antibody [EPR3338] (ab96379)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-MEK1 antibody [E342] - BSA and Azide free (ab239802)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-MEK1 (phospho T292) antibody [EPR2365Y] (ab76314)

    Applications: WB

  •  
  • Product image

    Anti-MEK1 antibody [E342] (ab32091)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-DLC1 antibody (ab168790)

  •  
  • Product image

    Human TMEM97 knockout HEK-293T cell lysate (ab258723)

  •  
  • (R)-(+)-SKF38393 hydrochloride, D<sub>1</sub> partial agonist (ab120619)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.