Anti-KMT2B / MLL4 antibody [4C10] (ab56770)
Key features and details
- Mouse monoclonal [4C10] to KMT2B / MLL4
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-KMT2B / MLL4 antibody [4C10]
See all KMT2B / MLL4 primary antibodies -
Description
Mouse monoclonal [4C10] to KMT2B / MLL4 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment -
Immunogen
Recombinant fragment (proprietary-tag) corresponding to Human KMT2B/ MLL4 aa 813-904. Entrez gene ID: 9757
Sequence:KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESP VQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
Database link: Q9UMN6 -
General notes
This product was changed from ascites to tissue culture supernatant on 11th June 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
4C10 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Western blot against tagged recombinant protein immunogen using ab56770 MLL4 antibody at 1ug/ml. Predicted band size of immunogen is 36 kDa
This image was generated using the ascites version of the product.
-
Overlay histogram showing HL60 cells stained with ab56770 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab56770, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Unlabelled sample (blue line). Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.
This image was generated using the ascites version of the product.

