Anti-GPRC5A antibody (ab155557)
Key features and details
- Rabbit polyclonal to GPRC5A
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GPRC5A antibody
See all GPRC5A primary antibodies -
Description
Rabbit polyclonal to GPRC5A -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanWB Human -
Immunogen
Synthetic peptide corresponding to Human GPRC5A aa 1-45 (N terminal).
Sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAF
Database link: Q8NFJ5 -
Positive control
- 293T, A431, H1299, HeLa, HepG2, Molt-4 and Raji cell lysates; CAL27 xenograft tissue.
-
General notes
This product was previously labelled as RAI3
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-GPRC5A antibody (ab155557) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : HepG2 cell lysate
Lysates/proteins at 30 µg per lane.
Secondary
All lanes : HRP-conjugated anti-rabbit IgG antibody
Predicted band size: 40 kDa
-
All lanes : Anti-GPRC5A antibody (ab155557) at 1/1000 dilution
Lane 1 : H1299 whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : HepG2 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 40 kDa
10% SDS PAGE -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPRC5A antibody (ab155557)
Immunohistochemical analysis of paraffin-embedded Human CAL27 xenograft tissue labeling GPRC5A with ab155557 at 1/100 dilution.