Anti-GPCR GPRC5D antibody [6D9] (ab55044)
![Anti-GPCR GPRC5D antibody [6D9] (ab55044)](https://www.abcam.com/ps/products/55/ab55044/Images/ab55044-68197-anti-gpcr-gprc5d-antibody-western-blot.jpg "Anti-GPCR GPRC5D antibody [6D9] (ab55044)")
Key features and details
- Mouse monoclonal [6D9] to GPCR GPRC5D
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgG2b
Overview
-
Product name
Anti-GPCR GPRC5D antibody [6D9]
See all GPCR GPRC5D primary antibodies -
Description
Mouse monoclonal [6D9] to GPCR GPRC5D -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human GPCR GPRC5D aa 261-346.
Sequence:ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVA LTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
-
General notes
This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
6D9 -
Isotype
IgG2b -
Light chain type
kappa -
Research areas
Images
-
Western blot - Anti-GPCR GPRC5D antibody [6D9] (ab55044)
Western blot against tagged recombinant protein immunogen using ab55044 GPCR GPRC5D antibody at 1ug/ml. Predicted band size of immunogen is 35 kDa.
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.
This image was generated using the ascites version of the product.
