Anti-GPCR GPR119 antibody (ab75312)
Key features and details
- Rabbit polyclonal to GPCR GPR119
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GPCR GPR119 antibody
See all GPCR GPR119 primary antibodies -
Description
Rabbit polyclonal to GPCR GPR119 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanWB Human
-
Immunogen
Synthetic peptide:
KMEHAGAMAGGYRSPRTPSDFKALRTVSVL
, corresponding to internal sequence amino acids 201-230 of Human GPCR GPR119
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 0.87% Sodium chloride, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-GPCR GPR119 antibody (ab75312)All lanes : Anti-GPCR GPR119 antibody (ab75312) at 1/500 dilution
Lane 1 : extracts from K562 cells
Lane 2 : extracts from K562 cells with immunising peptide at 10 µg
Lysates/proteins at 30 µg per lane.
Predicted band size: 37 kDa
Observed band size: 37 kDa
Additional bands at: 28 kDa, 60 kDa. We are unsure as to the identity of these extra bands.
-
Immunocytochemistry/ Immunofluorescence - Anti-GPCR GPR119 antibody (ab75312)Left panel: immunofluorescence analysis of MCF-7 cells, using 1/500 ab75312. Right panel: same, after pre-incubation with the immunizing peptide.
