Anti-FRMD8 antibody (ab169933)
Key features and details
- Rabbit polyclonal to FRMD8
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FRMD8 antibody
See all FRMD8 primary antibodies -
Description
Rabbit polyclonal to FRMD8 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human FRMD8 aa 17-153.
Sequence:SHRSSVSSVGARAADVLVYLADDTVVPLAVENLPSLSAHELHRAVREVLQ LPDIALDVFA LWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTSAPDDDVAMDEPFLQFR RNVFFPKRRE LQIHDEEVLRLLYEEAK
Database link: Q9BZ67 -
Positive control
- HeLa and Jurkat cell lysates; Human fetal colon tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200ul sterile Water with 50% glycerol to a final concentration of 0.5 mg/ml -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FRMD8 antibody (ab169933)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human fetal colon labelling FRMD8 with ab169933 at a dilution of 1/100.
-
All lanes : Anti-FRMD8 antibody (ab169933) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : Jurkat cell lysate
Predicted band size: 45, 51 kDa