Anti-EID1 antibody [26] (ab78323)
Key features and details
- Mouse monoclonal [26] to EID1
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-EID1 antibody [26]
See all EID1 primary antibodies -
Description
Mouse monoclonal [26] to EID1 -
Host species
Mouse -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Cynomolgus monkey, Orangutan
-
Immunogen
Synthetic peptide:
YEKTPFDQLAFIEELFSLMVVNRLTEELGC
, corresponding to amino acids 159 - 187 of Human EID1 -
Positive control
- extracts from MCF7 cells transfected with EID1
-
General notes
Clone number: #26
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 6
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Ion Exchange Chromatography -
Purification notes
ab78323 was purified by propriety chromatography under mild conditions as IgG fraction from serum free growth medium of mouse hybridoma clone and sterilized by filtration. -
Clonality
Monoclonal -
Clone number
26 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
ab78323 staining EID1 in HeLA cells by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with 4% paraformaldehyde, permeabilized with Triton X-100 0.25% in PBS and blocked with 1.5% BSA for 30 minutes. Samples were incubated with primary antibody (1/100 in PBS + 1% BSA) overnight at 4°C. An Alexa Fluor®488-conjugated Goat anti-mouse IgG polyclonal (1/1000 in PBS + 1% BSA) was used as the secondary antibody incubated for 1 hour. DAPI was used to stain the nuclear DNA.
-
All lanes : Anti-EID1 antibody [26] (ab78323) at 1 µg/ml
Lane 1 : extracts from MCF7 cells transfected with control
vector pCMV1
Lane 2 : extracts from MCF7 cells transfected with the EID1 expression
vector pcDNA3/EID1
Secondary
All lanes : HRP-conjugated mouse IgG
Predicted band size: 21 kDa
Observed band size: 21 kDa

