Anti-EDR1 / PHC1 antibody [1F3F3] (ab175424)
Key features and details
- Mouse monoclonal [1F3F3] to EDR1 / PHC1
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2b
Overview
-
Product name
Anti-EDR1 / PHC1 antibody [1F3F3] -
Description
Mouse monoclonal [1F3F3] to EDR1 / PHC1 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human EDR1/ PHC1 aa 758-1004. Expressed in E. Coli.
Sequence:LKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYA PAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRG PRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAG HGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIASLQGCQE IAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET
Database link: P78364 -
Positive control
- EDR1 / PHC1 recombinant protein; HEK293 cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
0.5% protein stabilizer -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1F3F3 -
Isotype
IgG2b -
Research areas
Images
-
All lanes : Anti-EDR1 / PHC1 antibody [1F3F3] (ab175424) at 1/500 dilution
Lane 1 : HEK293 cell lysate
Lane 2 : EDR1/PHC1 (amino acids 758-1004)-hIgGFc transfected HEK293 cell lysate
Predicted band size: 106 kDa
-
Anti-EDR1 / PHC1 antibody [1F3F3] (ab175424) at 1/500 dilution + EDR1/PHC1 recombinant protein (amino acids 758-1004).
Predicted band size: 106 kDa
-
Flow cytometric analysis of HEK293 cells labeling EDR1 / PHC1 with ab175424 at 1/200 dilution (green) and negative control (red).