Anti-C1orf25 antibody (ab121883)
Key features and details
- Rabbit polyclonal to C1orf25
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-C1orf25 antibody -
Description
Rabbit polyclonal to C1orf25 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human C1orf25 aa 574-671.
Sequence:QFSIHASSNVNKQEENGVFIKTTDDTTTDNYIAQGKRKSNEMITNLGKKQ KTDVSTEHPPFYYNIHRHSIKGMNMPKLKKFLCYLSQAGFRVSRTHFD
Database link: Q7Z2T5 -
Positive control
- Human placenta tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus and nucleoli. Recommended concentration of ab121883 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-C1orf25 antibody (ab121883)ab121883 at 1/200 dilution staining C1orf25 in Paraffin-embedded Human Placenta tissue by Immunohistochemistry.
-
All lanes : Anti-C1orf25 antibody (ab121883)
Lane 1 : Negative control (vector only transfected HEK293T lysate)
Lane 2 : Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10.