Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)
Key features and details
- Mouse monoclonal [M11-14b-D10] to beta Defensin 1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-beta Defensin 1 antibody [M11-14b-D10]
See all beta Defensin 1 primary antibodies -
Description
Mouse monoclonal [M11-14b-D10] to beta Defensin 1 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Baboon, Macaque monkey -
Immunogen
Synthetic peptide:
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
, corresponding to amino acids 1-36 of Human beta 1 Defensin.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: 0.79% Tris HCl -
Concentration information loading...
-
Purity
Protein L purified -
Clonality
Monoclonal -
Clone number
M11-14b-D10 -
Isotype
IgG1 -
Research areas
Images
-
ab14425 (2µg/ml) staining beta defensin in human kidney, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining in the epithelial layers of the loops of Henle, distal tubules and collecting ducts.
Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.